GenomeNet

>ypd:YPD4_3372 glpA; anaerobic glycerol-3-phosphate dehydrogenase subunit A; K00111 glycerol-3-phosphate dehydrogenase [EC:1.1.5.3] (A)
MTNSSPYLETDVIIIGGGATGAGIARDCARRGLACTLLERHDIATGATGRNHGLLHSGAR
YAVTDGESARECIEENRILKRIARHCIEQTDGLFITLPEDSLAYQLQFIARCRDAGIEAE
AIDPAQALRLEPAVNPALIAAVRVPDGTVDPFRLTAANMLDAREHGANILTYHEVIGLLR
QGSRINGVCVFDHKNQRKYDIHAQIVVNAAGIWGQHIAEYADLRIRMFPAKGALLILGHR
INNMVINRCRKPADADILVPGDTISLIGTTSTHINYDQIDNMVVTAQEVDTLIREGAKLS
PQLAQTRILRAYAGVRPLVASDDDPSGRNVSRGIVLLDHASRDGVEGFITITGGKLMTYR
LMAEWATDKVCEKLGISAACTTAQVPLPGSRQSAEQTLSKVISLPASIRGSAVYRHGDRA
TQLLVGNRLDNSLVCECEAVTAGEVRYAVESLSVNNLLDLRRRTRVGMGTCQGELCACRA
AGLLSRFKVTTPQQSREQLTQFLNERWKGVRPIAWGDALRESEFTQWVYQGLCGLDEIPA
TVNAREKHDEI

BLAST