GenomeNet

>yph:YPC_2131 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) tdk; thymidine kinase/deoxyuridine kinase (A)
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTLVFTAEIDNRFGVGTVSSRIGLSSQAQ
LYNSGTSLLSIIAAEHQDTPIHCILLDECQFLTKEQVQELCQVVDELHLPVLCYGLRTDF
LGELFPGSKYLLAWADKLVELKTICHCGRKANMVLRLDEQGRAVHNGEQVVIGGNESYVS
VCRRHYKEAIKAACCS

BLAST