GenomeNet

>yph:YPC_4600 malS; alpha-amylase protein (EC:3.2.1.1); K01176 alpha-amylase [EC:3.2.1.1] (A)
MKRLTLPLLLVLSPAAMANWSLQHFPAFTEQDSGIFLSSSSLTKGEYPLKFYQDKQCWQP
TGPVKLNQMLSLQPCQENIAIPWRLFRDGQYQARIDTRSGTPTLTLSVTAPVAEAVQVVT
HVCQRWDGNPVTVDVSKTFAEGEIVRDFYSGQTATVSLGKITLRPAPESGGLLLLESAQT
QQAAPFSWQNATVYFALTDRFNNGNPANDHSYGRHGDGMQEIGTFHGGDLAGLTEKLDYL
QQLGVNALWISSPLEQIHGWVGGGTKGDFPHYAYHGYYGLDWTRLDANMGTEQDLRTLVE
QAHKRGIRILFDVVMNHVGYATLADMQNDQFGALYLQGDQQEKTLGKRWSDWTPGSGQTW
HSFNDYINFSDKTAWDNWWGKKWIRTDIGDYDTPGYDDLTMSLAFLPDIKTESTQPSGLP
VFYRNKPDTAAQEIAGATPRDYMTHWLSQWVRDYGIDGFRVDTAKHVEKPAWQQLKQQSI
AALAEWKAAHPEQALDNLPFWMTGEAWGHGVMKSDYYQNGFDAMINFDFQDQANQALACF
SSIESTYNQMAEKLQNFNVLSYLSSHDTRLFFKDDAQQSLAKQQRAGSLLLLAPGAVQIF
YGDESGRKFGPTGSDPLQGTRSDMNWSELSGEKGALLAHWQKVSQFRARHPAIGAGVQQS
QQTANYYAFSRQHQGDKVLVVWVGDKN

BLAST