GenomeNet

>yph:YPC_4600 K01176 alpha-amylase [EC:3.2.1.1] | (GenBank) malS; alpha-amylase protein (A)
MKRLTLPLLLVLSPAAMANWSLQHFPAFTEQDSGIFLSSSSLTKGEYPLKFYQDKQCWQP
TGPVKLNQMLSLQPCQENIAIPWRLFRDGQYQARIDTRSGTPTLTLSVTAPVAEAVQVVT
HVCQRWDGNPVTVDVSKTFAEGEIVRDFYSGQTATVSLGKITLRPAPESGGLLLLESAQT
QQAAPFSWQNATVYFALTDRFNNGNPANDHSYGRHGDGMQEIGTFHGGDLAGLTEKLDYL
QQLGVNALWISSPLEQIHGWVGGGTKGDFPHYAYHGYYGLDWTRLDANMGTEQDLRTLVE
QAHKRGIRILFDVVMNHVGYATLADMQNDQFGALYLQGDQQEKTLGKRWSDWTPGSGQTW
HSFNDYINFSDKTAWDNWWGKKWIRTDIGDYDTPGYDDLTMSLAFLPDIKTESTQPSGLP
VFYRNKPDTAAQEIAGATPRDYMTHWLSQWVRDYGIDGFRVDTAKHVEKPAWQQLKQQSI
AALAEWKAAHPEQALDNLPFWMTGEAWGHGVMKSDYYQNGFDAMINFDFQDQANQALACF
SSIESTYNQMAEKLQNFNVLSYLSSHDTRLFFKDDAQQSLAKQQRAGSLLLLAPGAVQIF
YGDESGRKFGPTGSDPLQGTRSDMNWSELSGEKGALLAHWQKVSQFRARHPAIGAGVQQS
QQTANYYAFSRQHQGDKVLVVWVGDKN

BLAST