GenomeNet

>ypn:YPN_3724 K01176 alpha-amylase [EC:3.2.1.1] | (GenBank) alpha-amylase protein (A)
MKRLTLPLLLVLSPAAMANWSLQHFPAFTEQDSGIFLSSSSLTKGEYPLKFYQDKQCWQP
TGPVKLNQMLSLQPCQENIAIPWRLFRDGQYQARIDTRSGTPTLTLSVTAPVAEAVQVVT
HVCQRWDGNPVTVDVSKTFAEGEIVRDFYSGQTATVSLGKITLRPAPESGGLLLLESAQT
QQAAPFSWQNATVYFALTDRFNNGNPANDHSYGRHGDGMQEIGTFHGGDLAGLTEKLDYL
QQLGVNALWISSPLEQIHGWVGGGTKGDFPHYAYHGYYGLDWTRLDANMGTEQDLRTLVE
QAHKRGIRILFDVVMNHVGYATLADMQNDQFGALYLQGDQQEKTLGKRWSDWTPGSGQTW
HSFNDYINFSDKTAWDNWWGKKWIRTDIGDYDTPGYDDLTMSLAFLPDIKTESTQPSGLP
VFYRNKPDTAAQEIAGATPRDYMTHWLSQWVRDYGIDGFRVDTAKHVEKPAWQQLKQQSI
AALAEWKAAHPEQALDNLPFWMTGEAWGHGVMKSDYYQNGFDAMINFDFQDQANQALACF
SSIESTYNQMAEKLQNFNVLSYLSSHDTRLFFKDDAQQSLAKQQRAGSLLLLAPGAVQIF
YGDESGRKFGPTGSDPLQGTRSDMNWSELSGEKGALLAHWQKVSQFRARHPAIGAGVQQS
QQTANYYAFSRQHQGDKVLVVWVGDKN

BLAST