GenomeNet

>ypt:A1122_15270 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) thymidine kinase (EC:2.7.1.21) (A)
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTLVFTAEIDNRFGVGTVSSRIGLSSQAQ
LYNSGTSLLSIIAAEHQDTPIHCILLDECQFLTKEQVQELCQVVDELHLPVLCYGLRTDF
LGELFPGSKYLLAWADKLVELKTICHCGRKANMVLRLDEQGRAVHNGEQVVIGGNESYVS
VCRRHYKEAIKAACCS

BLAST