GenomeNet

>zma:100194312 putative SET-domain containing protein family; K11423 histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43] (A)
MPDLSTSYLPPFPELSLDAGALAVDHAGNAAAAASADAASAYASSSASVGSGVDDLVIPA
ECRWKGHVRTFDMAGAGAVTTCPAARRGGGKKLSLIPSLEPARTQASASAPTLEERVSEW
AAKKAAAGVPTHHCVLPFLTGAPMAVECRLCSKIIYVGEEIKCSVKKCPQMFHLKCVAED
TSNFTVESFRCPQHTKRCGWGAVALEPLERGDFVIEYVGEVIDDATCEQRLWDIRRRGDK
NFYMCEISKDFTIDATFKGNVSRFLNHSCEPNCKLEKWQVDGETRVGVFASRSIEVGEPL
TYDYRFVHFGEKVKCHCEAVNCQGYLGSQIKNPIQSILATVAPQVQLREYSPMHHEAPRL
KPINHLLPWTNCIEVSFNLRSKRKIDRLCWARKKKRTSLVPSSTSMPASPSEVPAADF

BLAST