GenomeNet

>zma:100194312 K11423 histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43] | (RefSeq) putative SET-domain containing protein family (A)
MPDLSTSYLPPFPELSLDAGALAVDHAGNAAAAASADAASAYASSSASVGSGVDDLVIPA
ECRWKGHVRTFDMAGAGAVTTCPAARRGGGKKLSLIPSLEPARTQASASAPTLEERVSEW
AAKKAAAGVPTHHCVLPFLTGAPMAVECRLCSKIIYVGEEIKCSVKKCPQMFHLKCVAED
TSNFTVESFRCPQHTKRCGWGAVALEPLERGDFVIEYVGEVIDDATCEQRLWDIRRRGDK
NFYMCEISKDFTIDATFKGNVSRFLNHSCEPNCKLEKWQVDGETRVGVFASRSIEVGEPL
TYDYRFVHFGEKVKCHCEAVNCQGYLGSQIKNPIQSILATVAPQVQLREYSPMHHEAPRL
KPINHLLPWTNCIEVSFNLRSKRKIDRLCWARKKKRTSLVPSSTSMPASPSEVPAADF

BLAST