GenomeNet

>zma:100273302 K01580 glutamate decarboxylase [EC:4.1.1.15] | (RefSeq) uncharacterized protein LOC100273302 (A)
MALALSTCRTCRSSRYELGEKSVSKDAAYQIIHDELLLDSSPRLNLASFVTTWMEPECDK
LILEGINKNYADMDEYPVTTELQNRCVNIIARLFHAPVGASEKAVGVGTVGSSEAIMLAG
LAFKRRWQNRRRAAGQPCDRPNIVTGANVQVCWEKFARYFEVELKEVRLREGCYVMDPDE
AVRMVDDNTICVAAILGSTLTGEFEDVRRLNDLLAANNRRTGWDTPIHVDAASGGFIAPF
LYPDLEWDFRLPLVKSINVSGHKYGLVYAGVGWVVWRSKEDLPDELIFHINYLGADQPTF
TLNFSKGSSQIIAQYYQFLRLGFEGYRNVMENCMESARTLREGLERTGRFTIISKEQGVP
LVAFTFKAKDETPLAFKLSAELRRFGWIVPAYTMPANLEHMAVLRVVVREDFGRPLAERF
LSHVRMALEELDHAAKGGPVPKMRLTIELGPPARGSGEEASARVVKREAVVPVHRSVSLA
GGKTKGVC

BLAST