GenomeNet

>zma:100279930 K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] | (RefSeq) TIDP3457; uncharacterized protein LOC100279930 (A)
MWRSCVSRGLSRAKASASRLLSTASSSYTVVDHTYDAVVVGAGGAGLRAAIGLSEHGFNT
ACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSDWLGDQDSIQYMCREAP
KAVIELENYGLPFSRTEEGKIYQRAFGGQSLDFGKGGQAYRCACAADRTGHAMLHTLYGQ
AMKHNTQFFVEYFALDLLMDNEGKCQGIIALNMEDGTLHRFRASNTILATGGYGRAYFSA
TSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGSRGEGGILRNSEGERF
MERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLPPEVLKERLPGISET
AAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVDIKGDNPDAVVPGLMAAGEAACAS
VHGANRLGANSLLDIVVFGRACANRVADISKPGEKQKPLEKDAGEKTIAWLDKLRNANGS
LPTSKIRLNMQRVMQNNAAVFRTQETLEEGCELISKTWESFHDVKLSDQSLIWNSDLIET
LELENLLINACITMYSAEARKESRGAHAREDFTTRDDEKWMKHSLGYWENEKVRLAYRPV
HMNTLDDEVESFPPKARVY

BLAST