GenomeNet

>zma:100383492 putative alpha-amylase family protein; K01176 alpha-amylase [EC:3.2.1.1] (A)
MMKHSSSLCLLFLLALCTTLLACGLVQAQVLFQGFNWESCKQQGGWYNRLKAQVDDIAKA
GVTHVWLPPPSHSVSPQGYMPGRLYDLDASKYGTAAELKSLIAAFHGRGVQCVADIVINH
RCAEKKDARGVYCIFEGGTPDDRLDWGPGMICSDDTQYSDGTGHRDTGEGFAAAPDIDHL
NPRVQRELSAWLNWLRSDAVGFDGWRLDFAKGYSPAVARMYVESTGPPSFVVAEIWNSLS
YSGDGKPAPNQDQCRQELLDWTRAVGGPAMAFDFPTKGLLQAGVQGELWRLRDSSGNAAG
LIGWAPEKAVTFVDNHDTGSTQKLWPFPSDKVMQGYAYILTHPGVPCIFYDHMFDWNLKQ
EISTLSAIRARNGIRAGSKLRILVADADAYVAVVDEKVMVKIGTRYGVSSVVPSDFHPAA
HGKDYCVWEKASLRVPAGRHL

BLAST