GenomeNet

>zma:542090 SET104; SET domain-containing protein SET104; K11420 euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43] (A)
METGAAAAPASRADGVRRCKILVPWRFQPGFVRQPLKQAANDAAVNGDGGNTAGAPDAKS
CRADGAASDGGETNVFRDAKKFGSGRATRGKNGEVDGGEEHSERCTSSQSLKSPDVENGG
RPGPGDACNLGESVRGGWVKSSPLEGTGNSRGANGGVEAGEDYNLGSSNCDASWKDARTQ
EFRGAGDGAACDPEVIESNVGAEKCFAKGLKKPFMDQTGSKSNGSSAPGLESEDPEGNVG
LEDSSYQAAKGCSMGDGAAKENEATANGCSSATPGSIGNGTYVRKGRKAAVPWRFQARYK
RSFSDAFGSNNESPDLPAYMFDSSSTQCTPATRSTVRCYASAHSGVRVSAMNNFSVKGDT
ECKKRKTNNDYQDESMLNNGGVVVRERIMRSLQDLRLIYRDLLDEEDNSREKVLNVRPDL
KAYRIFRERFCTDFDDEKYIGSVPGIYPGDIFHLRVELCVVGLHRPHRVGIDCTKKDDGT
TVAVSIVSCAQSHDIKYNLDAFVYTGLVAVAVNQRIEGTNLALKKSMDTNTPVRVIHGFT
TFNGKKKFPAYIYGGLYLVEKYWREKEHGDRYVYMFRLRRMEGQKHIDIQEILQTGNSGS
NDNVIIKDLSRGLERVPLPVVNKISDERPMPYCYISHLRYPRNYRPTPPAGCNCVGGCSD
SNKCACAVKNGGEIPFNDKGRIVEAKPLVYECGPSCKCPPTCHNRVGQHGLKFRLQIFKT
KSMGWGVRTLEFIPSGSFVCEYIGEVLEDEEAQKRTNDEYLFAIGHNYYDKSLWEGLSRS
IPSLQKGPGKDDENETGFAVDASEMGNFAKFINHNCTPNIYAQNVLYDHEEISVPHIMFF
ACDDIRPNQELAYHYNYKIDQVHDANGNIKKKKCLCGSVECDGWLY

BLAST