GenomeNet

>zpr:ZPR_2491 K01190 beta-galactosidase [EC:3.2.1.23] | (GenBank) glycoside hydrolase family protein (A)
MIAYKQYIINKLYLGTLAIVSFLLFACQKKEEDPEVFNRKQLFTEDWKFYKNDTLNSLTE
VLNSEDWRPIDVPHDWSIHQEFDKNSAAGIGGGALSGGVGYYKKSFNLPLEDSTRLYKIQ
FDGVYQNSEVWINGSYLGKRPNGYIGFEYDLTPYLHYGSQDNTIVVKADNSDQPNSRWYS
GSGIYRNVWLKKLNKIHIPNWGTFITTPSISKEKALVNITAKIKNEFLEDKEIEVQITIF
QDDQEIVKSETSALNITTNSEIGFNKELTIYKPKLWSIDSPWLYKAQIDIIQNKNLIDRF
ETRFGIRDFKFDFEKGFKLNGESLKIRGVCMHHDLGPLGAAINTRAIERQLEILKEMGVN
GIRTAHNPPAPELLDLCDQMGFIVMDEAFDIWTTAKTKHDYSQYWDKWHEQDIADLIKRD
RNHPSVFLWSIGNEIQEQWSEKGEKIGIELSNIVKSLDSKRPVTAGMNPPVHVSDKEVTI
QFEETADKPNSLAGSGALDVIGYNYAHQTWEKHQLNFPNTPFIATETTSGLQTRGYYEFP
SDTTKIWPVRWDKLFTGGNPDHTISAFDQVRAPWGSLHETSWKIIKKNDFLSGFFIWTGF
DYIGEPTPYEWPSRSSYFGIVDLAGFPKDVYYMYKSEWTDDDVLHLLPHWNWEQGQTVDV
WAYYNNADEVELFLNGESRGTRSKRDDELHVMWRFPFESGTLKAISRKNGQIVKETEIRT
ASKPAKLELFPDRKKIRADGLDLSFITVTITDAEGTIAPRANNQIDFEIEGPGEIVGVSS
GDPTNHESFKGKSHRALNGKCLVIVQSTRQAGEIKISANSAGLESNSAVLISH

BLAST