GenomeNet

>zpr:ZPR_2825 K01176 alpha-amylase [EC:3.2.1.1] | (GenBank) alpha-amylase precursor, GH13 family protein (A)
MKKTFKNKPIFYLLILVIFFSCSSDDDTTTVDPDDDSSIGQPEPVSALNLAEYDNGSGVM
MQAFYWDVEPRFEWWNTISDKLGSWADAGVNRIWIPPASKGQSGGYSMGYDPSDYYDFGE
YDQHGTIPTRFGTREDLEQMISVAHDNDIEVIADMVLNHNSGGGLEYNPYREKETYTLFD
ETHGNASGMFNRNYEDFYPNSVSNYDPGSLFYQETNLDHHRERVQNWLWKDENSVAKYYK
NVMGFDGWRFDYVLGFEDFVIKDWLEEVGGFSVSELWDGNPGVLRNHIEATGSGVFDFAA
FYVMEQAFDRNHDLKGLTNDQVWQTNPEKAVTFTANHDTEKDANEDNIIAPENKLKAYAF
IMTHPGYPTVFYLDYENPEFQEQLNKLIRIHNSLATGSLEIIYADNDEYIMQRSGNSENP
GLILYMNISASAKRRTITTSWDSYILMDYSENSNYHPKVSEDGEVTIEAPANSYAIWSIT
E

BLAST