GenomeNet

>zro:ZYRO0A11990g hypothetical protein; K13524 4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22] (A)
MLRVRQAATKTKGMAPRYLNGADSTARRTLLVPTRNFQTSTIRMSVTSKYYPNEPTKPLV
KTESIPGPISKKEIAELDKVFDARPAYFVADYEKSLGNYIADVDGNLYLDLYAQIASIAL
GYNNPALIKAAQSQEMIRALVDRPALANFPSKDLTNSLSKLLKFAPKGQDHVWPALSGAD
ANELAFKAAFMFRQSHERGYDTEFSKEENDSVMDNQAPGSPQLSVLSFRRAFHGRLFASG
SSTNSKPLHKLDFPAFDWPHAEYPTYKFPLEENEAANRAEDDRCLKQVEDLIVTWKNPVA
ALIVEPIQSEGGDNHASKYFLQSLRDITLKHNVVYIIDEVQTGVGATGKFWCHEYADIQP
PVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFNTWCGEPARLLIAGAIGDEIVNKGLLEQ
VQRVGKYLFGKLEQLQKQYPDKLQNLRGKDRGTFIAWDLPTGEQRDLLLKKLKLNGCNVG
GCSTSSVRLRPSLTFEEKHADIFVDALTKSIKEL

BLAST