GenomeNet

>zro:ZYRO0C16390g K11482 histone deacetylase HOS1 [EC:3.5.1.98] | (RefSeq) hypothetical protein (A)
MGKLVIASSQFQSQVADLLPCNKWRRSQLVHGLIDCYSLLEKFDHVISKPYCDKRELLKF
HAESYIDTLLNSSYNQLLPYDEAESSWTQLIEMDKDWSHRHDTKVTTHWSTRAQLYEHFQ
GLRSRKRSADEVDSNDTPQEIDSKVFNLEGDCPIFSYLPMYCQVVTGATLMLADYIESNT
QDERTIAINWDGGRHHAMKKRASGFCYVNDIVLLIQKLRSKGFQRLSYIDFDLHHGDGVE
RAFQFSSNVQTISMHLFECGFFPTSGSLEDNKKGKNIANIPLAHGLNDEYLNEIVTQVVI
PLTDRHSPQVIIIQCGGDGLMGDEYNEWQLTIKGLCENILKIVNRYKNCSIVLLGGGGYN
PTVMSRFYTYLTGKLIDPNFLQDEDTIIPEHKFIDAYHDEHYKFWAYEMEGSLLRKTLKN
ENEFKFINEIKSHYGI

BLAST