GenomeNet

>zro:ZYRO0D14916g hypothetical protein; K02358 elongation factor Tu (A)
MSLFPRLAPRLVSRNFLKPQCVARSFTTTLRASAAAFDRSKPHLNVGTIGHVDHGKTTLT
AALTKTLAKNGGADFLEYASIDKAPEERARGITISTAHVEYQTDKRHYSHVDCPGHADYI
KNMITGAAQMDGAIIVVAATDGQMPQTREHLLLARQVGVQHIVVFVNKVDMMDDPEMLEL
VEMEMRELLSEYGFDGDNVPIIMGSALCALEGKRPEIGEDAIMKLLDAVDEYIPTPSRDM
EKPFLLPVEDIFSISGRGTVVTGRVERGNLKKGEEIEIVGHNTAPLRTTVTGIEMFRKEL
DQAMAGDNAGILLRGIKRDQLKRGMVLAKPGSVKSHTRFLASLYILSKDEGGRHSGFGEN
YRPQVYIRTADVTVILKFPSEVEDHSMQVLPGDNVEMECELIHPTPLEVGQRFNIREGGK
TVGTGLITRIMD

BLAST