GenomeNet

>zro:ZYRO0E09878g hypothetical protein; K00844 hexokinase [EC:2.7.1.1] (A)
MVHLGPKKPPARKGSMADMPQDLLDQVRGLEVIFSVSTEKLRAVTKHFIDELQKGLSKKG
GNIPMIPGWVLEYPTGKETGNYLAIDLGGTNLRVVLVKLNGDRTFDSSQSKYKLPHHMRT
TRNPKDLFDFIASSLKNFIEEEFPNGCEDTLPLGFTFSYPASQGKINEGVLQRWTKGFDI
PGVEGHDVVPMLQESLSEKGVPINVVALINDTTGTLVASHYTDPETQMGVIFGTGVNGAY
YDVCKDIEKLQGQLPEDITPDTLMGINCEYGSFDNEHVVLPRTKYDVIVDEESPRPGQQS
FEKMSSGYYLGEIIRLVLIDLHEQGFIFKDQDVSKLREPYVMDTSYPSMIEEDPFENLED
TFDLFQKDLGITTTTPERKLIRRLCELIGTRAARLSVCGIAAICQKRGYKTAHIAADGSV
FNKYPGFKERAAAALNDIYGWGIEDRHKQPIQIVAAEDGSGAGAAIIAALTQQRLAANKS
VGVIGK

BLAST