GenomeNet

>ztr:MYCGRDRAFT_55383 HKX2; hypothetical protein; K00844 hexokinase [EC:2.7.1.1] (A)
MDEYLHNVRSQFEAPLHIDRLLEISKQLQQECRDRLQASDISMLPSYQRSLPTGEERGDF
LALDVGGSTFRIALIRLAGKTKAEHSSTCSATHTPDTPCRSDSLQIRRIRTFTIDETVRR
LRGEAFFDWMADRIGDMLHEYNHIRGTSNAHLPMGLAWSFPIEQTSPHSGRLLAMGKGFL
ATHGVENQDLSSLIMRSCRAKKLNVEMRAIVNDSAATLLAQSYRDSSVRMSLILGTGTNA
AVYLPVSSLHPSKFGDRPESWFSDTTHVLVNTELSMLGKRSLPRTHWDDQLNASHPLPDF
QPLEYLITGRYLAEIFRLVLLEAEGSIVDFFSLPPAWRTTPYSVDASLLAIFEADTTPTL
SLSRAAILPHYPPDSKTQILAPDLSFLRSIAQSITCRASTYLATALHALWVVRCEAEGLR
PTTDQSRVSVACAGSIVEKYPGYRQRAQRVLDELCGVGECEEGYVRLGCSGESSVVGAAV
AV

BLAST