GenomeNet

>ztr:MYCGRDRAFT_67035 hypothetical protein (A)
MRKDTRKSMEQLGTLLKAIRAPLPTQTGDGSALPQPKKDTFSKDVREILRDIPRQDIDDI
EGLIKVFKSTAMGENLDDKEYLMESMIAVATKLPESFLQDRLTTTLVTTLWNDLEHPPNV
ILGEEYEFRQPDGSNNNFKYPNVGKAGMPYARTVNPKSKQGGVLPDPGVLFDTVMARKHE
AGEKHPNRISSMLFYLASIIIHDIFRTDHLDARISNTSSYLDLSPLYGSNWKEQKTMRTF
QNGKIKPDCFAETRLLSFPPGCGALLIMFNRYHNYVVEQLALINEDGRFTENPRQVTVDR
YGETGLNKRDDDLFQTARLIVCGLYINIILIDYVRTILNLNRTDDNWQLDPRVDIPGGIP
VATGNQCSAEFNLVYRWHSAVSERDDLWTQQLFKELPLPDGLTAEDAAKPENMKKFLMTL
AHMQHDTESKDPTERDFPALKSEKMDRIPEGPFKGNYKDDDLAALLTSSIEDCANAMGPQ
QVPAVMKAIEILGIQQARTWRCATLNEFREHFHLKPHKTFEDITTNKEVSEALKHLYNTP
DDVELYPGLVVEDDKQAKLPGSGLCPSYTTSRGVLSDAVALVRGDRFYTTAYTPASLTNW
GFQEASSDLSIDNGCVFYKLFLRALPNSYDPGSVYVHYPMTIPDEMKTILQGLEKDHMYN
FDKPKASHHPVTLFSHAAGMQVTENQEDFHVTWGPAMIFLMGPEAKNFMLAGDGPENAKS
RAMMEKTMYQGIPSGNEKWLTAVRDFYEMKTTELLKQKSYKLAGVNNVDIIRDIGNLAHV
HFCAELFSIPLKTEKFPLGIFTEQQLYLIMAAVFTCVFFDLDPPKSFPLRQKARAATQSL
GNIMKAQVQSVKTFGKLAESLIDVVKPNDGPLGDYGVHMIAQLCKQDVDVDDLVWGNIMG
TAGGMVANQGQLLGQALDYFFTTGKDHLPEINRLAKLDTPEADDTLMHYLMEGARLNGET
AIFRTVTKDTTVVDNTPLLGEQVHHLKKGDTVFVNLKSASRDAAAYPNPDALDLTRDLNS
YITLGHGVHQCMGLPMTRVALTTMLKVIGRLDNLRPAPVSVGTQSVGHSVKKVMKEFVPG
DKHVLPEEWHYHLYLTEDWDQYFPFPTSKFEMV

BLAST