GenomeNet

>ztr:MYCGRDRAFT_71291 SDG2401; ESC/E(Z) complex protein; K11430 histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43] (A)
MRFHCPYHGELVEHSPSDDELPEEDEAIVQTDIIHPPRINHRSRVTFPPSVDEGDPNVPI
KDRRAASTWLATTASLNTTPETRGPFYPCHHPGESCVSAKCSCWRAKITCEKICSCAPSC
PRKFQGCSCSNDRARANGGTSKKNQKYVCFEDARCACFQSGRECDPDLCGECGVCDILDP
VHRHDDRILQARCRNASIQRGVPKHTILGDSGVHGLGLYACEDIRAHEYVGEYKGEIITK
EEADRRGSVYEHQKLSYLFSLNQKQEIDSTYFGTKIRFINHAGDGKGNNLYPRIIMVNTV
YRIALYASRNIRAGEELFFDYGPMFPDEQ

BLAST