GenomeNet

>ztr:MYCGRDRAFT_74146 K00235 succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1] | (RefSeq) SDH2; succinate dehydrogenase (ubiquinone) iron-sulfur subunit (A)
MALRLATRRFAPIAFRRGMATTIEHTKEPISATAEALSASRPPIKETKTSTVKEPQMDAD
AKTKTFHIYRWNPDQPTDKPRMQSYTLDLNKTGPMMLDALIRIKNEVDPTLTFRRSCREG
ICGSCAMNIDGVNTLACLCRIPTDTAKETRIYPLPHTYVVKDLVPDMTQFYKQYKSIKPY
LQRDTAPPDGKENRQSVADRKKLDGLYECILCACCSTSCPSYWWNSEEYLGPAVLLQSYR
WINDSRDEKTAQRKDALNNSMSLYRCHTILNCSRTCPKGLNPALAIAEIKKSMAFTG

BLAST