GenomeNet

>tr:A0A017SA40_9EURO [A0A017SA40] RecName: Full=Translation machinery-associated protein 22 {ECO:0000256|RuleBase:RU361273};
MAEVAESGPIEPQAKHVVYCGVCTLPSEYCEFGGTAKKCEEWLRDSHPDLHEQLYSEEAV
SANLSNLSLSVRERAAKDAAKKEAKAAAAETRDAERKAASKVQIKRIERNKRKHVTVITG
LEVHGLENKKVAKELGKKFATGSSVTKSAAGVEEITVQGDVSDDVQEWLVEIKGIPEVNT
ELVEDKKKKSTT

BLAST