GenomeNet

>tr:A0A021XCX6_9RHIZ [A0A021XCX6] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:EYR83056.1};
MRGSPAFAIAPPRRAVYAAAMRLRSDIFVSALMRRVFARGDFAAVEVKGAEEAGAVFVRQ
VFRDGTESLYGPAPQSVFEAEESGLRRFEARLERVEAAAVADALARERRFDGDLWVVSIE
ADALDDLIEFAGAEPKDDGFFRR

BLAST