GenomeNet

>tr:A0A059ELA3_9MICR [A0A059ELA3] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:KCZ75529.1}; Flags: Fragment;
MIDYVSFLKECLTPFHTVKYLKDLLNNCGFKEYKINDKLQTGKYYYIYRTMMVIFKIPKN
PSFFRIIGTHNDSPVLKLKPNPFFSSGNMTMLNLKTYGGGLFHTFFDRPLVLGGLIITKD
GEKVITMKDVAYIPSLAPHSAREIYKDGFTYNREDHLKAILLKEELKELLSDALSFDLSL
IEERITDTGEFI

BLAST