GenomeNet

>tr:A0A074WZQ7_9PEZI [A0A074WZQ7] SubName: Full=STAG-domain-containing protein {ECO:0000313|EMBL:KEQ67911.1};
MSSPTSQPHDEAPDATNERRSRRSGRVSRKPELYIEEAPAASKRKRDAADDDQLDDQEES
DEEEESEPDEEELREQKARARKAKAAVPKKPAAKRSKTNGTSVALPARAGAKKGRSKKAK
GVDEAAAEEAGGLYAEVFARGNTLDEAAEGWLAAFNEHEAGALTDLQNVSEYPIIAKGKG
TAAFKESLMGFFRTLIKAIHTTDVLFTNPELIENMQVWFGTMSAAQNRPFRHTATVVSLT
IITALCEVGSELAEEASKALRHSETQKKGKNANKTRVSELQDYSKQAKAHQEKLNNTIKD
WFETVYIHRYRDVDPHIRADCTKAIGEWIVAYPDLYFNGKHLRYLGWVLSDSNHSARLEA
IKQLHRLYADKNKLGGLKAFTERFRGRMVEMATKDAESSVRAAAVELLDDLREGGLLEPD
DIDAIGRLIFDAEPRVRKSVVGFFAESINDAYEAKVDALGGQEALEEVIGEESDSFDSPC
HEWIKFKCLAEGLDSYDSADGHMPPSVERGPGQAAYLLHAGTTDSRFMIAADTLHDQIDE
VREWEKLAGYLLYDTSVEAQNGDAAGGESQLKQELTLTENEEVILLEVLNSSVKQAVASL
VEAHSDKKTKKTKKQKEDVEELQEQAARHLANVIPRLLKKFGESPQTAASTLRLGRVLSL
EAFQEFRQDSSTYAALLNDFNKQFLSHSNEEVLAEASRALLRAKSYHELGDVPDERIDSL
WEDTISTFNTITHGKDLETRGLLSTTVLDALSKTVLRLEKLSSISNPVEYFETEPSAPAT
ARPELPDPSPPIDSLITLINRAASPKGSDPETAALDDALAMHASRTVTFYFMWRIPAFIK
SLQTTALPDVELENLAMRRDAYVNALGAVLKTRPVNDELSVIVSGMLLDAHTIMATLRQV
TTDKNGDEYLVLALEMDAVLQKRILRVFGAAEAAFAKATGKHVEVEAENSQAQESEEDDE
EPADPIDADPVSEDEAEDEADAEGDDEQTQASQAKRVAKLQNSLLAEQRLCELSSKLVLA
ILGRMVNVAVVKQRLERNKTRLGHNFKLVLEHLDAQTKGKKGKGKAAAKTGAQQGKAKAA
APQQQKSTKVVVEDDEDEDEEEDEEAVRAREIQEDDEMVDEPEGGNQEEEQDEVANDAES
VIGD

BLAST