GenomeNet

>tr:A0A075B0L4_9FUNG [A0A075B0L4] SubName: Full=Translation initiation factor SUI1 domain-containing protein {ECO:0000313|EMBL:EPZ34351.1};
MSDTGLAQILPLELIDKCIGSKICALLKGNKEVSGTLLGFDDFVNMVLSDVTEVEQTVEG
KKITKMDQILLNDCTMPLEYCEFSGSLPKCKNILQKENPQKFAELYGEVDQTKEDTKETE
GNNEKVNASKKKTAKVPAIDKVLFKVEQRSFKKNVTVISNLEKFGIDLKKAAKRFANRFA
CGSTVAKNAQGREEIVVQGDVGDNLETFLMKEFAKELNNIEIEEIVEEKKKKGSE

BLAST