GenomeNet

>tr:A0A078B3N3_STYLE [A0A078B3N3] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:CDW87832.1};
MGAILSKIRGKVGQANASEKKKGINLDEHPILKTLTSQRKVEAMLRESDLKSQLMKGVFS
KDIQKVLGELDQIKSEGDQKKYEHDLTLAFWFSIHIENLEMSKQLIDREFLLKQLVACAL
IQKQVLENEESEEESEGNNWNDDGPQDDNQSGEQESQNLTEEEKEKDDQNHLQLEGGESD
DEMMDEDKKEDDEPTLTLKPPAYGHSELAAALKKAQQMKEEQRKLEEEKQSAETLAAIGI
DEETINRTQLKDQAELLRVKTSFRAKFHNLMTNVLKISLQKEEEKLACIIIAYYEVVLEE
EMIIRAITQNNYEFLQFTWAFDKNYIGIRNKNDAMFIHYEQLFDLIKKNRFVEKDLGPRA
EQVALYRDDFRKVLEWKIISLDNILKALLIHHEDELAVEYMGYYSHFLDKELFIHCMRNG
NTEFLQQALLLAAFDKMIFREDSVITEILEILSQGHRTNFLMNVLTLVDISVWKNKHLKE
LVEIISDYVEENYDKNRLLLSPNPLQSITLAAELLKKVANSRRKFENECNKIQNQLLELG
KMYSSKIEDEKYYESLIMGVDFRGRTVLKTITQNTFEPLMDEEDPKAENLMVMIWHGNDA
TKCDGNIFGYSNLSHIIMTRAKKQSGKNQTLMSMITNSYNANFKVDYSFQYTYRSQAISF
YFYKEFFCALAMLVIFQYINYQYLILFSNNYINSDDTADSATPTTETSINRIIRSVREYV
DWNFFALFFSCALIFQMILKILFNICARQRIGVDKWTIMDSLSAILNIAAVQVIQRVPPE
TYLKPKMKDLIDYFMILVLCVCWLRFFVYFLVVRSISKLLLTLLAMIGDTLSFMFIVCCF
ILIMASVFTTLYQDTNPEKYGGLALTVRTLFDAAIGQYDYENMEGRELSHSILLIGHVFF
SNILLMNYLIAILSTTYENMKQSGIFRYKVNLYKYCERFMIAFADRDYGEIVLHPPPVSY
LSAMMIPFLVSRKAMMYISKGFSYMMYWLENIFFVMAFAGFELAILPIAYIKVWINIIKN
SMGVLNTIVNCLVWLLIGIFMMIFLLFRDVLNLLIILSYHNGCKKASAQAVEDLNIEDNK
IKVYNETRATVISLYQRLQKHMRQEQIDDNDEDMDFDDDIFPIKDDENMNEDFLYVVKKS
LIIDEWKKRRTNSVKQKKIQEKLAGNKSSALGNLMAVSFRKQLQRQASGLNVKNSKQGAL
PNEKDSLWGGLRGSQNMKANQQNRPKDLTNHLRVVFLDRLKNSAVNQNDGDDVDMSDFAI
EESEIQLVDEFLTKFTIVSESSMNEHLDIMLMLKALPNKVMRNSLKQTDLFNFRIFQESL
IAYQNLDIVNAFEYFDDKNRERVQNVKDKLMNQRTNLNDVKDILDLVKIKIERNEQYFQQ
QKGMTSPANGESAPKITSGNLK

BLAST