GenomeNet

>tr:A0A084VFU2_ANOSI [A0A084VFU2] SubName: Full=AGAP000361-PA-like protein {ECO:0000313|EMBL:KFB36836.1};
MENFGYKEGSSKPKRRLTAKSLKRRNSQIPIKPRFSISPELNVHWMNDQEAMVTEDFEYM
KIGPSPPAESAPIIFDNYEESSTEFGIEISYETIRTALIEQIRLSSGRVHLLDSIEQGNM
VAANVAEYFGGASKTEKNISLLWAAFMKRWDLLEPLMDYGSELAFHDTNGFTALHLSAFS
GCLNCASVLVAKGLDVNLQPKAYTPLQCAAFGNSAHTALFLISKGARLDLNTRRQNGEES
LLHCAVRANAIDCVKLFIAEGMSVNSIKPSGMNAIHLAADLGHVDCLQVLLAAPDADANI
RIGIREKESTALHLAADEGNVACVGLLLEHGALANLKNHRGFTPLHLASRTSSLECVDLL
LRVGNADPNEEDFDMRTPLHTAIGKSESAFHIIETLICWGADVNKKDVFGFTPLHLSAID
GLAHCVEILLFYDADVTAKTKKGTTALNVITRKTPGSLAMITKKFDDAMTLMHSQNPSEK
EVELELDFRTILQHCYPREISYLNTLVDEGQKEILQHPLCSAFIYIKWGKIRKYYIARLL
FCFIFILFLTLYVLTALAHNCYNGSKDMEETIQEQELCQKQSILGNMLRRNPFVMEMQWL
VLVAITFVEICRKLYGITGYSSIRRYVTQMENITEWFIIVSVFVISYIYTKRTYTWQNHI
GAFAVLLGWTHLMVMIGQLPVFGAYVAMYTKVQVEFAKLFIAYSCMLVGFTISFCVIFPS
SSSFENPFMGFITVLVMMVGELDLELLINDPDGKDPPFMLELSAQITFVLFLLFVTVILM
NLLVGIAVDDIQALKKTATLSKLVGQTKLISYIESALFNGWLPNWLRSLLHYTALVSPRA
YRVILSVKPLNPEEKRLPRNIMMAAYEIAKEKEQQLGTPGEPGTIDPATGNVIPMPAAGT
EAGSEHNPQPAGQVATPNQTLCTLASKIDESAEKIGDVTRELQELKAVLMQNQQLIDEIA
RQICGSPKE

BLAST