GenomeNet

>tr:A0A087G4W1_ARAAL [A0A087G4W1] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:KFK24913.1};
MATLARLPLTHSFPTFFLPKALSFPSYRSRFRSFSTVSPILCSSSSQGDSKSLGSDSNAS
IVGDLLDYLNESWTQFHATAEAKRQLLAAGFDLISENEDWKLKPGGRYFFTRNMSCLVAF
AVGEKYVPGNGFHAIAAHTDSPCLKLKPKSASSKSGYLMVNVQTYGGGLWHTWFDRDLSV
AGRAIVRASDGSFVHRLVKVKRPLLRVSTLAIHLDRTVNSDGFKPNLETQLVPLLATKPD
ETSAESKDKNVSPSSKDAHHPLLMQILSDDLDCKVEDIVSLELNICDTQPSCLGGANNEF
IFSGRLDNLASSFCALRALIDSCESSESLSSEHDIRMIALFDNEEVGSDSCQGAGAPTMF
QAMRRIVSSLGNDQVTECTFDRAIRKSFLVSADMAHGVHPNFAEKHEENHRPQLHKGLVI
KHNANQRYATSGITSFLFKEVAKLHDLPVQEFVVRNDMGCGSTIGPILASGVGIRTVDCG
IAQLSMHSVREICGTDDIDIAYRHFKAFYRSFSSVDRKLVMDD

BLAST