GenomeNet

>tr:A0A091SSV8_9AVES [A0A091SSV8] SubName: Full=Transient receptor potential cation channel subfamily V member 5 {ECO:0000313|EMBL:KFQ61734.1}; Flags: Fragment;
RIWESPLLQAAKENNLTAIRKLLTDRTCDIYQRGAVGETALHVAALYDNVEAAVTLMEAA
PDLVNEMMTSELYEGQTALHIAAVNQNITLVKALLKRGANACTAQATGHFFRRSSQNLLY
FGEHVLSFAACVGNEEIVQLLIENGADIRAQDYLGNTVLHILVLQPNKTFACHMYSLILS
YDRNKEGPGSLELIPNNEGLTPFKLAGVEGNTVMFQYLMQKRKHNLWSFGPLTTVLYDLT
EIDSWAEDQSFLELIVSTKKREARQILDLTPVKELVSLKWNMYGRPYFCFLALFYILYMV
CFTMCCVYRPLKPRIGNKTSSRDNTIYVQKMLQESYMTYEDELRLVGELITVIGAVVILI
LEIPDILRVGAAKYFGQTILGGPFHIIVITYACMILVTMVMRLTSTTGEVVPMSFALVLG
WCNVMYFARGFQMLGPFTIMIQKMIFGDLMRFCWLMAVVILGFASAFYIIFQTENPENLG
QFYNYPMSLFTTFELFLTIIDGPANYDVDLPFMYSVVYFAFAIIATLLMLNLLIAMMGDT
HWRVAHERDELWRAQVVATTVMLERKLPRCLWPRSGICGLEYGLGDRWYLRVEDRVDPNK
HKMIRYTEAFKAQDRDNHDKGLEKLEINRNILCKKELSALSLSRSTSRTSSHRGWEILRR
NTFHQLCGEVGHAMEEEVYDV

BLAST