GenomeNet

>tr:A0A0B1QAM5_9RHIZ [A0A0B1QAM5] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:KHJ56426.1};
MSTTRQLPFELPHKASFDRADLIESDANCLAIEAIDSWPDWPHPVLMIVGPAGSGKTHIA
EAFAAMSGGSHARAGDVFEPQPGFVRVIDDVDRTDMAEEEIFAIVNAARAGLGHVLLTSR
TPAPLLRLRLPDLASRLRAATQIELGAPDDMLLHGVLVKLFADRQMDVDPKLLAYVLSRM
ERSIASAEALVARLDRESLASGRRITRGMVASVLEDGQA

BLAST