GenomeNet

>tr:A0A0D2VTT6_GOSRA [A0A0D2VTT6] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:KJB74710.1};
MNYPPEKVVRFQDWNSEKTCEGHYANNNGINSGKFTFAINSFSEKFQRGVESGSERIKAI
RKSFKSSSFNHVVAKGFGSSKKVLDPQGPFLQRWNKIFVLSCIIAVSIDPLFFYVPVVND
DKKCLALDEKMETTACVLRSFTDIFYIIHIIFQFRTGFIAPSSRVFGRGVLVEDSQAIAK
RYLRSYFLIDVLAVLPLPQLVILIIIPEMSGLKSLNTKNLLKIVVLFQYLPRVFRIYPLY
KEVTRTSGILTETAWAGAAFNLFLYMLASHVFGASWYLFSVEREFTCWKGACGNNTTCHR
SFYCDNGDSYFRTLLNQSCPIQTPNTTLFNFGIFLDALQSGIVESKDFPEKFFYCFWWGL
QNLSSLGQNLETSTYVFEICFAVFISISGLVLFSFLIGNMQTYLQSTTTRLEEMRVKRRD
AEQWMSHRLLPENLRERIRRYEQYRWQETRGVDEENLLRNLPKDLRRDIKRHLCLALLMR
VGALTFYSFFLTGLHTF

BLAST