GenomeNet

>tr:A0A0F4YTW6_TALEM [A0A0F4YTW6] RecName: Full=V-type proton ATPase subunit a {ECO:0000256|RuleBase:RU361189};
MAPKDTFFRSADMSLTQLYIANEIGREVVSALGEIGEVQFRDLNPDVNAFQRTFTKEIRR
LDNVERQLRMEYPFVVPSLSSFFFLRAGLEADPVFGTPAGYFQSQMEKAGIPMRPSSEFA
NILAAPSAAEIDELAERSDSLEQRIASLNDSYETLKKREVELIEWRWVLREAGGFFDRAH
GHTEDIRQSFDNDEAPLLRDVEHQVPRGQNGDAQGQQSFSVMNIGFVAGVIPRDRIGAFE
RILWRTLRGNLYMNQSEIPEPIIDPTTNEEVYKNVFVIFAHGKEILVKIRKISESLNASL
YSVDENSELRRDQIHEVNTRLSDVESVLRNTKNTLDAELTQIARSLAAWMIIVKKEKAVY
HTLNKFSYDQARKTLIAEAWCPTNSLPLIKSTLQDVNDRAGLSVPTIVNQIKTNKTPPSY
VKTNKFTEAFQTIINAYGITKYSEVNPGLPTIITFPFLFAVMFGDFGHGLLMTLTAAAMI
FWEKKLARTKLDELTYMAFYGRYIMLLMGIFSMYTGLIYNDVFSLSFTLFPSQWKWPENI
REGQAVEASLKDGYRYPFGLDWNWHEAENALLFTNSFKMKLSILLGWAHYINARHFKSKV
DIFGNFIPGMIFFQSIFGYLVVTIVYKWSVDWNARGESPPGLLNMLIFMFLNPGQVEQEL
YPGQGGVQVILLLLAIVQVPTMLLLKPLWLRYEHNRARALGYRGIGEQERVSALDEDGDL
DGRPSEGRDSLASDGEGVAMIAQDLDEGEHEEFDFADIMIHQVIHTIEFCLNCISHTASY
LRLWALSLAHQQLSIVLWKMTLGGSFETESPGLRVVMIVCTFYLWFVLTVFILCVMEGTS
AMLHSLRLHWVEAMSKHFIGDGIPFQPFSFKTLLEENPVD

BLAST