GenomeNet

>tr:A0A0K6FQ32_9HOMO [A0A0K6FQ32] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:CUA68350.1};
MFEPTPDHYADSLFAFTNLDRLAINSKFLAHGQSRLPESILTAIRSSPNLKSLELDLGEP
NIETDRTWSPNKLFKEVGLVFPELHTLRLGGRVVPQWPLTLSKPSTSLRLFFEQHQALQS
ISIAWTPGLNEQSDLGPEIVVTLFPSVRHFEGPAFLCVSVLRSPLALQLESLSVLDKHIG
NSKAKHINELANAAESLPKLSTLNFYLESESQAQYRAIREISRVAPNLREVCVQGLHIDL
KMSIVEALRHASNLRGGTAGLALAARLSDNPKVSVGVIEAGLYYENDPLINTPAFASQLQ
GNAKYDWMFNSTPQSHVNNRILPLPRGKALGGSSTINLMVFNRASRAEYDAWGKIGNPGW
NWNSLLPHMKSAERFTGIDPFRANHTESSSGNIYPSQGTNGSVAASFNTWYSDIVLPYRR
SMANLDVPINLDPDSGDPFGLYNSATAVNRTTGARSYAANTYFAYNSDRQNFVVLTGAQA
AKIEFRNSTSGKPDGKLSATGVSYVHNSTTYIVKAKKEVILSAGSFQTPQLLELSGIGNF
TILRQNGITPLIDLPGVGENLQDHLFLSSSYELKPGITTLDILRNNASYAAAAQAQYATT
HDGILTSSISILSFLNLDYLISQIELSNAIVKLNQEIAADKITKLQEVQYEIQKDWLKKR
VGHLEVVLSPGYFGSGAPKANTSYASLSMVLQHPFSRGNVHVNSSDSMASPRIDPNYLSK
SIDQETFIQALKFGLKIFQTEPLASLVVARQDPSPEISSDDAYTEYVKSNARTIHHPIGT
AALAPRAIGGVVDTSLKVYGTSNVRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXGGVDINHSGDGGLYGELLQNRAFQIVTPHTSQALNAWSAYKGTKLDV
TNGIAGVSASLPNSLQATVPAGSTGQVGFDNSGYWGIKVQKGWKYTGSFYARSDSYTGTV
TVSLVSTSGTVYATKTVSKVTSSWKKFTFDFTPSQSAPDVKNVFRVTVDGASASGKSIYF
GLFSLFPPTYKGRPNGMRIDLGEALAATKPRVWRFPGGNNLEGQFIASRWKWNETIGPLE
NRPGRQGDWGYPNTDGLGLLEYLDWAEDIGAEPILGIWAGYALQGETVPESEIHIYVEDA
IKEIQFVTGDANTNQWAKLRAQYGRKDPYKVKYIEIGNEDFFASGSYAFVNGLKAAFPNS
GFEYIATTYPSTALDPAYTYIDWHQYNTPKWFIDRAVEYDTYPRNGTQIFVGEYAVISTN
SSCLFGTPACGRLEYPTLQGAVAEAAYMTGLERNSDVIFATAYAPTLQHINGYQWTPDII
TFDAGSIVKSASYYVQQVSFPKLLANATLICILVAFRR

BLAST