GenomeNet

>tr:A0A0M2SRV2_9BACI [A0A0M2SRV2] RecName: Full=Chromosomal replication initiator protein DnaA {ECO:0000256|HAMAP-Rule:MF_00377, ECO:0000256|RuleBase:RU000577, ECO:0000256|SAAS:SAAS00724181};
MENIADLWNNALSKIEKKISKPSFDTWLKSTKAHSLQGDTLTITAPNEFARDWLEERYSQ
LISSILYEITGEELGIKFIIPQNQNDEEFSVPVPPKKAIKDDDQHDLPNNMLNPKYTFDT
FVIGSGNRFAHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHYVQDHNPSAKVVY
LSSEKFTNEFINSIRDNKAVEFRNKYRKVDVLLIDDIQFLAGKESTQEEFFHTFNTLHEE
SKQIIISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETRIAILRKKAKAEGLDIPNE
VMLYIANQIDSNIRELEGALIRVVAFSSLINKDINADLAAEALKNIIPSSKPKVITILDI
QRTVGQHFNVKLEDFKAKKRTKSVAFPRQIAMYLSRELTDFSLPKIGEEFGGRDHTTVIH
AHEKISKLLSTDSALQRQLRDIHEELKI

BLAST