GenomeNet

>tr:A0A0Q0VT04_9DELT [A0A0Q0VT04] RecName: Full=V-type ATP synthase subunit I {ECO:0000256|RuleBase:RU361189};
MFIKSDIRRITIALEKAFYSEVYLALGKAGIIHLARFSERDSLGDTGLHEEETLAGEIIS
GTEYNLNALAITPEESGISALTVDKNQDAALVFELKKIIERAMRLRTKIREKENITARQM
EYAEVLNRMSVESAVIKKARLVKIIFGTVENAIGDISSDSRFILNMIDNYVLGICLPSDY
PALFQFLKNYGFTDKSDEVNPLPLKMIKRRLEILQRRGEIVDTYLNQLKKEKGQMLKELN
SSYRCYDEMLKAMRMSLFSSKAMFITGWIDTRDRQKLLNTMERICGNRFIFSERKDPDAP
VRLLNMKLFKPFELIVRTMGMPSNSEIDPTPLTAITFIFMFGLMFGDLGQGLVLMLCGFI
LRMYGGKKMKENLLQAGGILIACGISAAICGLFYGSVFSSEHVIPALWFHPTTHIMKLFT
TTILTGVVFIMTGLLVNIINNILNSDYTEALLEKRGLAILVIYATIIFFAVIYQRTGKLP
APWKISIFVILPLILFSLKGVLGPVFFQKEKPHNIAEYIVETIMEIVEIALSLFANTISF
IRVGAFALSHAGLSIVTYTLAGIADPNLKSAGAIIVIITGNIFIIGFEGLICGIQSMRLE
YYEFFSKFFKGDGVAFSPFTLKVKTSEV

BLAST