GenomeNet

>tr:A0A0S4K5N7_9BURK [A0A0S4K5N7] RecName: Full=Flagellar brake protein YcgR {ECO:0000256|HAMAP-Rule:MF_01457}; AltName: Full=Cyclic di-GMP binding protein YcgR {ECO:0000256|HAMAP-Rule:MF_01457};
MQSTNDSDIESWHDFEVASRKEIIALLRGIGEKRQLVRMVIRRGTEVCVSAILDVDPDNN
TLTLDGSADPEQHRRFANVGRMAFETSLDKIRILFASEEVHATTFEDTPAFTIPIPETLI
RLQRREFYRMATPVSNPVSVVIRLPQDAGGGTHVFPLADISCGGIAILDNKLVLGSTIGQ
SYTGCRIDLPDVGAVQTTLMIRNSVDLTLLNDKTNRRLGCAFVDISRGGLASVQKYITKL
ERERNARLAGLG

BLAST