GenomeNet

>tr:A0A0S8A7P3_9GAMM [A0A0S8A7P3] RecName: Full=V-type ATP synthase subunit I {ECO:0000256|RuleBase:RU361189};
MRPVPARWFEVLIATDDLVHAVETLARTGDVELEMYSETTQRVSMPNLRDRFANFDRLLR
RYQDYWPKQSLRASEQPGRPETRLDTALEKLADWQVEADPSIDKLETLLREQDELSLVRE
MLTNMPSDLLDFSRVASAGPTLTARLFVLPVNAKIEHLPPAVLSIRVITEQHIFLLVVGK
EDTVDAMQRDMVVQKAQTIVMPAWLEGNLQSAIQQVKERQAAISSETDALYHELDELAQQ
HHLHEVLGDIQQLEWFITHVSDLPVSENFAWITGWTSDVSENRINDVLQKENLRAVVHYP
PAPVGVRPPMVFQNPWWSKPFELFAKLLGVPAANEFDPSILLSILVPLIFGYMFGDVGHG
LVFFIAGLLLYRRWPLVKLLISCGLSSMVFGWVFGSVFASEHLIKPLWVNPIHDPLIVLL
VPLVGGVVVLLMGLLVNGIQQFWQGAIKQWLSIDAAVIVMYLGLIGGALDPQVGFIVLLG
VVWYLVGNVLLTRESYGAAIGHAVGQLLESVLQLLINTISFIRVGAFALAHAGLSLAVII
MTNTIENTFFSILILVVGNLIILILEGLVVSIQTTRLVLFEFFIRFLKGTGRMFHPLSVP
KKPEQEAKQKQTDVSTNAGTRRTIS

BLAST