GenomeNet

>tr:A0A0V1HB22_9BILA [A0A0V1HB22] SubName: Full=Translocon-associated protein subunit alpha {ECO:0000313|EMBL:KRZ07348.1};
MNESSRLDKMVFGKWFITAVCLLLISIPVRNVLSADEDDDDALVEEESDKLKAGGGKSLG
DSDDEEVVEGLAPSPDIEAVVLFTEPPNSKELPAGKPAHMLISFFNGGIDEYFVDNIQAF
LKYPTDYSYNIHNYSIHSYHQAVYPDTEASFEYSMMAFDTLAGRPFGLVVLVDYKLADGR
EFRSTVFNETVHIVEEESAFNPEMIFLVMVFVIIGCLVAVFAYQFIAGKSRKHVVKKRVQ
VEMGTTNAGDVDLDWIPKQILAMSERSRQPAQKTSPRMRKNGKNAHQAKARAD

BLAST