GenomeNet

>tr:A0A101VQZ0_9BACT [A0A101VQZ0] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:KUO59099.1};
MKIANIYIFFFVLMTTKLFSQNFSSGFNFNLSTYDSTEQKYLPLFDNYDLGGNDFISISN
DGHFSFRGDKIRFWGINMVADGAFPAKNVTRKITNRLKKFGVNLVRLHHIDNGWSKTGSL
FTGLDTREIDQVQLDKLDFLIYHLKRNGIFVNLNLNVSRTFSAFDGVPDADSLLEFAKGV
TLFDRQLIELQKEYASQILTHVNPYTGLAVSEDPVLAMVEIINENSLYRLWKDDKLKPIN
KGGQFTSRHSIMLDSLFNLYLIEKYNSNQNLVTAWNKDVIPEGNINLVKNNGFETYILSP
DWMMEVHSTAKAIPEIDKTTSYTGINSAKINVTSVTDQEWHLQFKQATLSVQKDTVYSIS
FAAKADSPKKISLTMSRNNDPYTWYNGFSFNLTTEWQYFTVKFKATETNLNNTRLAFSFN
NTIGTYWIDEVSMRKSGLKGLLEDENLELRNINRIAYNECSGFTTSRVVDMSEFYAKTQS
DFQKEMSSYIKNELKIKVPIVGTNWGNGVLDSYFQSGMDYVDNHAYWDHPSFPNEPWSIT
DWRIDNTPMVKNAFGGTINTLFKPKAELNKPYTISEYNHPFPNRFQVESMIFLPAYSSFH
NVDATMLFDYYGGNKWEDDFIDGYFSVGKNHLIMSMFPTAALAFRKGYIKNESNPILLNF
SKEFLLTIPKTDDSGWSGNTFLPDGLPLTNSFRVADYYASFTTAISSLPSTSKVKFTSST
NEIKLDTESGFLSVDAEKYFAVTGFLKKTKNYEYSSAKLLSVNDDDFGAISWISLDDKAL
YQSEYSLITVTSKIQNSSMIWNGTNTINNNWGKKPTQIFPMNIEIELTLEADSISLTPLD
NLGMEIISSSKYIKPISSNKFRVVLNQNENRTVWFGIKKYGNGIGTGILDGKEIDYNYQL
NQNYPNPFNPTTTISFSLKTNSITELKIYDLLGREIKTLIEGEELSAGNHFYMLNSEGLA
SGIYFYKITAGNFSDTKKLIILK

BLAST