GenomeNet

>tr:A0A135TFS7_9PEZI [A0A135TFS7] RecName: Full=V-type proton ATPase subunit a {ECO:0000256|RuleBase:RU361189};
MAPAQDTMFRSANMSMVQLYISNEIGREVVTALGELGLLQFRDLNGDVSAFQRTFTQEIR
RLDNVERQLRYFYAQMEKAGIPLRKFDVDAERLANPSTSEIDELAERSQSLEQRVFQLND
SYETLKKREVELTEWRWVLREAGGFFDRAHGSVEEIRASTDNDDAPLLQDVEQHNSAPEV
ERSFSGMNIGFVAGVINRDRVASFERILWRTLRGNLYMNQSEIPEPLVDPTNNEEINKNV
FVIFAHGKEILAKIRKISESMGAEVYNVDENSDLRRDQIHEVNARLNDVQNVLRNTQQTL
NAELTQISQALSAWMVLVTKEKAVYNTLNNFSYDRARRTLIAEGWCPTNDLPLIRSTLQN
VTNQAGLSVPSIINEIRTNKTPPTYIKTNKFTEAFQTIVNAYGTPTYQEVNPALPVIVTF
PFLFAVMFGDFGHAVIMVSAALAMIYWEKPLKKVTFELFAMLYYGRYIALVMGLFSLFTG
LIYNDVFSKSLTLFDSAWKWDVPDDYKPPQTLTGKLNDHGYRYPFGLDWRWHETDNDLLF
SNSYKMKMSIVLGWAHMTYSLIFAYVNAKHFKKPVDIWGNFVPGMIFFQSIFGYLVMCIL
YKWSVNWSDPQNPRNPPGLLNMLIYMFLQPGKLEDGAQLYPGQATVQVFLLLLAVIQVPI
LLFLKPFWLRWEHNHARAKGYRGIGESSRVSALDGDDDEDHGLNGRPSFESDGEGVAMIT
QDLHGDGEHEEFEFSEVMIHQVIHTIEFCLNCVSHTASYLRLWALSLAHQQLSSVLWSMT
LGPALGFSGIFGSIAIVVVFYMWFFLTIAILVMMEGTSAMLHSLRLAWVESFSKFAEFAG
WAFQPFSFTTTLEESEELKEYLG

BLAST