GenomeNet

>tr:A0A151PDD3_ALLMI [A0A151PDD3] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:KYO46980.1};
MPHTEPARAICGTFHRYTFTGIYTFESLIKILARGFCLNEFTFLRDPWNWLDFIVIVLAY
AGEFSDLGSVSVLRTFRVLRALKTISIVPGKKPDLGIQSQTLRASGKIYMLFFMLVIFLG
SFYLVNLILAVVTMAYEDQNKATIAETEAKERQFREAMELLKKEQETPLYDETSKMHLPR
HLSVEYFNESLQRERAASAVSIITSALEELEESQRKCPPCLNKFAVKYLIWDYCPLWLQI
KKRVSLFVMDPFIDLSITLCIVLNTIFMALEHHNMSKDFNHMLKIGNQVLNLFIALLLNS
FSATNLQTAEDDSEMNNLRIAVARIRRAVYLENHLRQRGEHCKSPAGWSKGSEGSCEDLS
EFSIGGQWKVESPSLEQKESDVFSSSEASTVDLTDPDEILKQIPELSENLKEPNNCFPDG
FIQYFPCCMVDTTHFPGRQWWNLRKTCYRIIEHPWFESFIIFMILLSSGALVFEDVHLSE
RPRIKIMLEFLDKMFTFIFVLEMLLKWVAYGFKEYFTNAWCWLDFLIVDVSLASLIANLL
GYSEVGPMKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIMNVLLVCLIFWLIFSIM
GVNLFAGKFQKCVNLTEEDSELSHLIENKNQCQSLNDTKKIYWINDKVNFDNVGSGYLAL
LQVATFKGWMEIMYAAVDSREESEQPKMESNRYMYLYFVIFIIFGSFFTLNLFVGVIIDN
FNEQKKKLGGEDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPLNKYQGFLFDIVTSQPFDI
AIITLICLNMVTMMVETDDQSATKTAVLNKINILFVAIFTGECVVKLLALRQYYFINAWN
IFDLIVVVISIVATLLSDLAKQFESYLSPTLFRVIRLARIGRILRLIRAAKGIRTLLFAL
MITSDGDILEEDAPEKEGLIALMMNENYDRIVDKSASMSTTSFPPSYDSVTGANNDNLKQ
EKLNKAICFHYLE

BLAST