GenomeNet

>tr:A0BZH2_PARTE [A0BZH2] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:CAK63939.1};
MLQSFLNCFKKQPKFRMNRDYEKDILSSVQDILPQSFQKHQYNKQNMNQIESHNKEFQAT
NDLNRLNQEQGIFSPNPSQANIRLHFLENVDEQFQKNENPYYCQFSLDYFGMNNKFRQYC
ILINESRVYQYSVYIFTTFCIVILMIKPYNGQKSGFGFSLNDDQILGVIVTADVIFAAHH
LISIVSYGYLEQLCRLWSCKYGYYRNPIAFINGIALFFALILRQSYFYTLRILFLLEFFM
HYKILRIVRKFCLTVEHSFISIVYITIIICFFFYVFAVVGLQIWTGIIGNQCINKDNEVD
YYPTRFCGLGRSCSDGYECQQAQFEQPFIQYSHNFTKFDYIQESMASLFIVHYIEGWVEI
EQSLADSFNKYVSTGYLWTYIFICSFFLQNLVVAIFLKQSQQEVHLDEPAQTVLFLNSHT
KISLTNEKRKTVFQSPNYLSRSKQRVMTMLMNSTKRSSDQRKIRVIIKSILSSKITQYFY
SLLFLANLVVLSLNDESAYINKLEGTLAKINVVFLVIYLIEDIARIYIWKQKESKIIVLL
EFICDFVGLIVQVNQLEHPFILNTIKGIRLLWVFNYQTSWSNYRVLLSALWKSFNNIPIM
ILILFIYGLVIGLMGRNFFAGKLRFNDLGFYDLDGSYIPRANFDSMRETITTLFIIISSD
QWQTIFYTTLETGSWIPYIFFICVQFICKFFILPSFLTLMLDNYEDAKNEADISKARATK
IISTMQNKSRIVPTKETSLLQVSNSQSEKKRFFGRLSKVSDDSEKEETHSKQHPALKRQQ
SKYQQVQIFKSSDDFQIISLYQQNWKEFFGNSSLFILHNRSNLRKKLHILIQSKYYDWAM
SFIILSNLILLGYDQPLRKENLVIDVFNYAFTGIFILDAFIKILAQGFYWNKQEPQKSYI
MNNNNQLDFVVLIISSLDDLNIYKSQYLRAFRALRTLRILITLRRGSQNEQLNLISRSLL
QTISLLSSMIFVTGISLWILSIICMTIWKGKLYFCSQVSLKDFQDIVNVEDCLAKGGQWI
NNITNYDTIQDSLLCLFRLIIGEGWTQQMFSVSDITNRGLNPKINSSSQYQFFFYVLIFS
LNIVLLNLITGLIINNYRTIKENIANFQQLNEFQRQWIQMMQIMQKKKLIYLIPKPSSKY
RLICYHLASNQYFETVILILLVVNLILQLLHSYLQSITTQEALYGMSIFFIVIFHVELFI
KLLAYWVHFFRDILNKFDIIILIVTDVLLIMKDSFDLPRLYTIPLIIRSLRIIKANKLFR
FNKQLRVLIDVIQDLIPTLLSVIVFIAITIIIYSLIGVQTFSTVWSTSSDPHQRTKSFSN
FLDGVLILIDISTGQYWSLYMADYTIDTKGCHAQTPEQFESEGARGCSTIFGYFFFISFL
VLIRIIMTSLFLAMIIESYQECQLENTAAINPYQLEDFLVKWSDYDPQGTGWITPEDFAF
LMFEINPPLGFKDENSQYYDFAAAKNQKLKSHFYNHKKKMRLFKTEIFQKLSDYQVQIYQ
NKMVHFKDICIQLAYNAIKKKNELKGIEQIEDKIILRQIRKSWESRYPDLVGMKTQQFVV
DIFAFNSITDILRGVIERRKIKKRIKEMQKEKNLKQLEINENAYITTKTLLERNKGRRRS
QIRKKVYNFQQTNVQRRSEINVDIEQAIHQPKRAMHQNYQKQQQNKDDKNSLTSLNFYID
PDEMCNGFPMKVVHETQKIDFPAIKSDKSLGTLQATQSEKQVKKLGGYISEKCSDEENQQ
DSVIQNFKRDDMFE

BLAST