GenomeNet

>tr:A0EYW5_9ABAC [A0EYW5] SubName: Full=Putative 12.5 kDa protein;
MSFEIPYERLGVKNIVDYIPLKLALNDTDESKNYSASNSAAGAKNDNDNLFYNNITSGRG
NEQRGSEHIILITLLSIFCIIVILYIVYAIYFFIILRDEQKSIAPQPVSF

BLAST