GenomeNet

>tr:A2SK86_METPP [A2SK86] SubName: Full=Regulatory inactivation of DnaA Hda protein {ECO:0000313|EMBL:ABM95975.1};
MKQLPLQLGPGPAQSFENFAVGANAAAVGAVRAASASPTPLYLWGPAGAGKSHLLRALAR
EAAVQGRRVGAFGPSLETPWTWGEGVDLVLLDGCDDFDAARQHAAFALFVEAATHRVPVV
AAGRLPPVDLPVREDLRTRLGWGPVFQLLPLAEAEMRVTLQREAGRRGIALSDDVTGYLL
TRFARDLGSLMALLDALDEFALSEQRAVTVPLLKRMLAEQTTKEGA

BLAST