GenomeNet

>tr:A5D6E8_PELTS [A5D6E8] RecName: Full=DNA gyrase subunit B {ECO:0000256|HAMAP-Rule:MF_01898}; EC=5.99.1.3 {ECO:0000256|HAMAP-Rule:MF_01898};
MYLALTGDTSNNNNSKYGAEEIQILEGLEAVRRRPGMYIGSTSARGLHHLVYEVVDNSID
EAMAGFCDRIEVILNEDGSATVIDNGRGIPVDIHPKTGRPAVEVVMTMLHAGGKFGGGGY
KVSGGLHGVGVSVVNALSLWLEVEVKRDGKVYYQRYSRGIPVTGLLVKGKSSATGTKVTF
MPDPEIFEDLIFNQDILAQRLRELSFLNMGVKIILKDRRSGQETVFQHDGGIMDFVRYLN
KSKTPLHGKPIYIQKQKDDVLVEVALQYTDTYVESILSYANNINTIDGGTHEAGFKAALT
RVINDYGRKYNLLKNGAGNLSGEDIREGLTAVISVKVPEPQFEGQTKTKLGNSEVRSIVD
SVVGEGLGIFLEENPSIARRILEKAVTASRAREAARKARELTRRKSALEGSTLPGKLADC
SERDPSVSELYLVEGDSAGGSAKQGRDRRFQAILPLRGKILNVEKARLDKILANEEIRAM
ITALGTGIGEEFDVSKARYHKIILMSDADVDGAHIRTLLLTFFYRYMRPLIEKGYVFIAQ
PPLYRVKKGKLEKYAYSDAELEKLLDQIGRDGVSIQRYKGLGEMNAEQLWETTMDPETRT
VMQVNLEDAIEADAVFSMLMGDRVEPRRDFIQENARLVRNLDI

BLAST