GenomeNet

>tr:A8XXD3_CAEBR [A8XXD3] SubName: Full=Protein CBG20269 {ECO:0000313|EMBL:CAP37322.1};
MNKENIVPETIELPSQEKSGKEIAQHVNQDEFKYLKQVEQILQEGSRRDDRTGTGTISIF
GMQSKYSLRNDTIPLLTTKRVYWKGVLEELLWFISGSTDGKLLMAKNVKIWEKNGDRAFL
DNLGFTSREEGDLGPVYGFQWRHFGAKYVDCHTDYTGQGIDQLAEVIRQIKEEPDSRRII
LSAWNPSELGQMVLPPCHTMCQFYVDNGELSCQLYQRSGDMGLGVPFNLASYGLLTHMIA
KVCGLKAGTLVHTLGDAHVYSNHVDALKTQMEREPYAFPKIRFTRDVSSIDDFTSDMIVL
EDYKCHGKIVMDMAV

BLAST