GenomeNet

>tr:A9MGB5_SALAR [A9MGB5] SubName: Full=Uncharacterized protein;
MKWYPWLRPAYEKLVESYQAGRGHHALLIQSLPGMGDEALSYALSRYLLCQQPEGHKSCG
HCRGCQLMQAGTHPDYYTLTPDKGKSSLGVDSVREVSEKLYEHSRLGGAKVVWIADAALL
TDAAANALLKTLEEPPEQTWFFLASPEPARLLATLRSRCRLHHLAPPSESYAMSWLSREV
TASQEALLTALRLNAGSPGAALALLQSERWAQREALCQALMDSLHTGDWYALLTALNHEQ
APARLHWLATLLVDALKRQHGASYLTNVDADAVVAALAGPLSPARIQAILNDVCHCRDQL
LHVTGLNRELVLTDLILRIEHYLQPGTLLPVPHL

BLAST