GenomeNet

>sp:RL33_RICRO [B0BVP6] RecName: Full=50S ribosomal protein L33 {ECO:0000255|HAMAP-Rule:MF_00294};
MAKKNKNVLVRLVSTAGTGVFWVKKRNPKTQTEKLSFRKYDKVVRKHVLFKEEKIK

BLAST