GenomeNet

>sp:RL23_THESQ [B1LBN8] RecName: Full=50S ribosomal protein L23 {ECO:0000255|HAMAP-Rule:MF_01369};
MKQEKLSLNDVLIRPIITEKALILREQRKYVFEVNPLANKNLVKEAVEKLFNVKVEKVNI
LNMKPKPKRRGIFEGKTRSWKKAVVTLKEGYTIKELEGEH

BLAST