GenomeNet

>tr:B3RK74_TRIAD [B3RK74] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:EDV29875.1};
MESVLFYLLEIEDSITLSCNLANKYDSIQQCRAILAAVGFGSRLCHLEHWINTERLPNMS
LCVFILEQAMSVRALQERVVATTSVTGSGSQAGRRTLLYGHAVLLRHTSSRKYLSCLSSC
STSDKLAFDVGLEQHSQDESCWWTIHPASHHRSEGEKVRLGDNVIFVNVYSERYLYVSTS
SNDLTVQASFQQTVWIVNPVMSGWALTKSRGYLNGGDVMRFIRGGDEYLSIPDDYKCGSE
EQHWWSSAFIRWGQPFRLRNVISGQYIGMSDDKKHLCLLTSEAAKSEDSALFCLQPSQDN
ICIWDEKDEINQGMGIPEIKFGDSLVFLRHYKTGLWVGPQTTHGQRKQVIKEPFPFNIIA
NKKSSDIKVHLLVEGHMDSALSVTRGETEEIRTAHIIKVCSELLYQFLSSLGTGNSDDNN
ELTIKHETEDVDLKALEYIVFILNDLLGYFAWQKENLAHEVKQKHRVALKKRQELFQNEG
VISLVLDVIGKICRDGDSKITFQDVQNDSMWFKIHDLLFKLLAAMIRENHTNCTKLVEAI
SLDWLLKRLEREHYIDGLLQVLLCILTESSQSLSSVKEQHIKCMINLLDKHGRDNRILDM
LSRICVCNGVAVRANQNLICDNLLPKQKLLLQTKLVDQITSVTANIYVGLFNGSAQHSKW
YFEVAVDHVEPPSQDSVLCVANKAASPISHLRIGWRNIKEVHHAEAGENWSGAGIGDSIF
SYGFDGVNLWTNGRYLSVKNKPVSKAKRTMKKSGSMFCFIGQEKLGLNHSLNIAKDDLDD
SMESSSVADFDSEDNSYNDVDNELNQSIQEDKLNEEAAKTAPHQFRNGDVIGCYLDLGKQ
SMTFSINGKLITGEFRDISIDKQLFSPAISMSSTVRCRLLLGGDYGEFNYNSRHYAPIYE
GLDYGESVRVQESMVLGNPYRYEIIGPTAQTEHSVFIPAPIDTTDVSLPTYLNDLRDKLA
INMHDIWARNKIDAGWKFGRDRSDTLKVHPCLRPFTELSQEEKEYDIKMAMETLKSLVAL
GYVINVVGEGKNVTKYQHLPDSKYLLSNGYKPHPLDLAQKEILNDHLEKVVEILAKNAHE
VWAKDRIQQGWSYGLSKDGDRKRNPMLIPYEKLDEQSMKSNRDTARETIRTIIGFGCTID
SPAVDLNVDSAKSLSRQVTDRAQNGSMRTFRVEKMYAVRRGKWYYEFHVNSPGMMRVGWC
SEFFEAGKEVGGSSNSYSYDGFLARKWNHGSESFGKTWNKGDIVGCLLDLDTGKISFTLN
GELLQDGMSSYAFEDIDVTVGYLPACSLAVGQSGRINFGHDPTSFKYFNIFGYQENYDPF
GIVTSDSIPLWFASGIATFETINDTHPTVKVTEWLMHTRDHPTLRVNSKPLRNSSDQSHK
KFDLLRLNYPVNFTVPMVSSSRRKKSKFLGKYCFTLRIFKAQDPYEIYVGWISSKLHNYG
NSFGDYSSRKATMKGWKKQSDNSDDQLSSTNTATQVQKLHNALPSYWSDTTRECYMARVS
DLIAERGKRKISSAVLGDILIDCYANVNTGKLDFAFNGSTCQFTHFDVEEGAKLYPAIYV
RTPNNDKNLFQIEFRISKDCLPVCFTSNSHKLSQKSDATHLIKRPVLQALKANTWCRMQT
SSLVTVEKALRHGYEIEREDPSYSVMINIPEENRCINLQELIEKEKLMYFHTHTLKLYSA
LCSHGNIYVADKIRYYVDEWQLMYCIQCFDLPDVVRVGYYDLLVSLHLEEHAKARLLTRG
EYILPLKVEKATPISFTSSKSDNTTVSNGSYSLSAAPLPGTVLSPHRKSGLTHDVSCTIE
GAQAQSYSIQHTSLDKPLFPLTPLKKHVFRTLQYHMQAINRSRKETHRESRSLLLVPLLK
VADCLLVMGVLDESDMELLLLLLDPQNFGSKMTVSQATLEVGLLRMTDLDEPVKLELCQL
LDHLCDCQLRYRVESLVAYTSNFVDALQKEQRRRHNEIRNSQYPVAVTARKTREFRIPPR
TQLLMLLSFKTRETAESNPCSKDLQVSLRSYHKDVLKHCGKGNGIIKTTESVAVIDRLKK
SLWSSSKSTKNLQLTNANRATLQEILAEVLIAWGKQSITDVALIKAIFRLWFRLHDGMAE
LAEAITKTYTINDVGGDNVTNLLKALGSVRSLLTVRMGATEEMQMTNGLKELMNNTIFFQ
HPDLMRVLGVHKTVMEVMVNVLGKEVEKQKGSQFQSWAGATMDLSASTSPKPDGQSEITR
KCLSPVMVAACCKFLCFFCRTSQQNQRAMFEHMTYLLSHSDTSVTCTSMVGATPLDVAAA
AMKDNLELVLALRKHHLERVVSLLALTAPSTKIQSISDAVDMLTSGSTKARSSSLLNRSN
TWSNRMLRARRNRIISKLEMMFDAGWEPKEGERYLDFLRHAIWVDNESVEENASLVVRLL
IRRPECLGPALGSEGMGICQAFREAISLSLSTDDSATVNGKSRSEVGTQTLSFYSNLIDL
AAKCSSANPIDSYVPSDIRVKAIAGTDHRKVALKTRDRIKAILQSLIPLREIIGVLSLEF
SLPVPNKDKNCMELETRGLIPSHKIAMVTFLDRVYGVDSQEVLLRLLNYAFLPDLTNSIS
LDEVPLSTEMISAINRYISGSVMRLLTNHAHLFNGADSQPELMAKTIDVCYRLSKCSFLN
AAGQDSVNGFLLAFTCELKPSLMIKSLRILAHDMPVLIEENSVGLSILASHFERCGKYYN
SSGGWCTLGTASAEEKTLTMVLFTQLLGALSKGSYSKKLFSCALSCLFSSACSLSPDYVL
SQPGQTISPAASLHRSLSTDFEDIYIPQPVNTVNVILTDELKHLIHSYACNKHDIWAHKQ
FTEGWSFGFESDEYDKKDSLLLPYNLLSQKDKYHLNKYMNDCLRTILASGWSITSHGDIT
KEELIPYRKSAVNTNVSQSPHGYCPAPLDVSSIELSAETENIAAFLADNAHQLKQFEALE
ASGKGAVILIPYHILPDEDKERYLSQTRDFLRYMKLFKFECTRADRCTSIFGDTLTQYFT
TEKRFAFCLLQSIIGYTRPIEYELKQRKSPTDPVANTDFYAKVCIPLVQHYFEIHQSYFI
ATENQQQTVYGAATAREKKMVATLFYKLAMIARNDCNLFGSPAIVVDCIQVIVTVLDIGA
LIFHGFQDSVSNLQKLLLTAAEDLNNVVISYESKLMRYIFDVLLPILCSLFRQIFKYDVN
GIFSYDKVKTACFGIINSLYRLGCNDKIRDQKHLADIGNCLNLISASFTMPFLELNHTTV
NLSLFVRPISSDPFDIDVLAAESKHLSHHYNDINIGTNHGGNLAKSSNEQSHNDNIRLSL
SESEISNSYALPTIDESPEIQSHSNLPHLNELLNMVDDYVYSNCGFKKSSYITDVILPML
CSYISHWICINGRNRYTNSTTTTDEGSKVNENYANFLLGHILRIINTNFVTHDIPTIYRI
GDYALPLIKHCSASLLDTHFLPVTKKLTDFAIDLYRREDRLTKVADYDAQDEVDVMEDYI
KLAQNVRTFYPMLIKLTDRHKQTWITGCNKTGEELFRYVADMFSCWHLSQNFRREEQIYN
SSTMGKSNSDLITQLNESVFQTFQKVGRSRFTSYNLFQESSNGNQSNSSLVIVCVRKLLA
VGLNFINLAQRQLMHEAKSKLIQKETDSDVLFYVINKVRKMGDESRWAKRIVTSSAALIL
GLSFDDVQKELALKIMEYSRVLHRLHIVDNPQKTITKSWKKILSQQRKRAIMKCFTRVPL
YNLPKYRAVNVFIDVYRELWLSGEKCDGNALVETLTSIKVDEDNPLESDPLSQLVLTICR
DASNHEGDFNADSELYKIYADIMSESCIKFSEEDDDDDVEDGSASTFEESERAKRRLDQQ
QSRLAERNAAQMVLILLTESNGVVSPTILSILRLGISLLRGGNQNVQEIMLKYLQSTRNV
NFFTSLAKLTTSCSVLDLDTYERSAKAEILGLGFSDVAAGSAIHNIEFICSLFRFLQLLC
EGHNLKFQDYLRTQAGNTTTVNIIVCTVDYLLRLQESISDFYWHYSSKEIIDIQGRENFS
KAIRVAKQVFRTLTEYIQGPCVANQFTMSNSRLWDAVGGFWHVFACLQMKLSKETCHLEL
LRELLKLHSEMVIMLLSMLEGSNANSGSIAKQLMETIIDSSEYIEMILKFFNMFLKLNDL
GSSKSFKEFDIDGDGWISPSEFQKAMEQHKIYSSTEIDYLLKCADTNHDGKLDYMEFTER
FQRPAQEIGFNLAVLIANLTDHVPDDPRLAHLEDLISGIMTYFESSLGRIEILGPSQRIE
RVYFEIKTEHIDQWQKPQIQDSKRTFLRDVVTNGNADKEKLENFVGFCEDTIFEMQYGAR
ISGTAKAEQIQRALEKRERDFDVPSPKPFLSSIRKKLSWKTIKNSVSPLAFLKLMLFCVI
LPISFSARFLMLLWIWINHTLNFSNLAKKDTKASRVEFIFPHLQKFKSLFSFTDVRKRSK
AISFLLTHLANFTIKSFSNIMGSSSENVMIEFDWDNEEDGEGKHSYKPKIAAAKQTILSL
FARSYYASRIIALLIAFGINIILLFCKVTPVTEKNETLSSLGNSIILDSSNNYLDLALII
LPILHLLASIATLIAYWNLKVPLAIFKREKEIARKLEFDGYWVTKSRSQDYRDWWDGIVI
NCGSFPSMYWDKFIKRKVRDKYSEHDNDYHRITQILNIEDDENASEKGRIQKMAELLDLK
YWIWRIGVICTDRNFIYLLFYLLFSLLGNCLNNFFFAVHLIDFGFGNKTLSTVLQSVTHH
GRQLIMTLLMMAVVIYIYAVVAFNFFRQYYSREIRGRPEYKCDHMFTCFMFHLNSGLRSG
GGIGDTIDPADGDLYEYERIAFDFTFFFFVIVILLAIVQGLIIDAFGELRDKQESVKEDL
ENKCFICGIGKEHFDKVPHGFDIHVEKEHNLANYMFFLLHLIEKPETEYTGQESYVWGLY
QQRRWEFFPVGDCFRDQYQREQQLLVNNT

BLAST